We noticed that you're using an unsupported browser. The TripAdvisor website may not display properly.We support the following browsers:
Windows: Internet Explorer, Mozilla Firefox, Google Chrome. Mac: Safari.
Traveller (96)
Room & Suite (25)
Pool & Beach (12)
You may also like:
See all
Nearby Hotels
  • Excellent59%
  • Very good30%
  • Average7%
  • Poor3%
  • Terrible1%
Travellers talk about
“a king size bed”(2 reviews)
“one night”(5 reviews)
Free Wifi
Free Parking
Breakfast included
Air Conditioning
Non-Smoking Rooms
Airport Transportation
4 Star Hotel
All hotel details
You may also like:
See all
Nearby Hotels
{"containerClass":null,"containerAttributes":null,"widget":{"name":"ibex_photo_carousel","template":"ibex_photo_carousel__widget","moduleList":["handlers"],"divClasses":"prw_rup prw_ibex_photo_carousel","js":{"handlers":"(ta.prwidgets.getjs(this,'handlers'))"},"dust":{"nav_controls":"ibex_photo_carousel__nav_controls"}},"scriptFlags":null}
3 Jun4 Jun
1 room, 2 adults, 0 children
Standard Room
Getting you more information on this room More
Free Cancellation
Book now, pay at stay!
Show Available Rooms
Sorry, this partner no longer has rooms available on TripAdvisor. Please visit one of our 7 partner sites to see rooms from US$69.
We're sorry, there are no rooms available on TripAdvisor. Please change your dates, or view all Stellenbosch hotels with availability
{"BOOKING_FEATURES": ["IB_PRICES_OUTSIDE_ROOM_BUTTON","IB_STREAMLINED_SELECTED_ROOM","IB_SHOW_EMAIL_FOR_INSECURE_LOGIN","VISA_SPONSORSHIP_WEB","IB_EXIT_INTERRUPTER","RCMS_INLINE_ROOM_GRID_MAX_OCC","IB_SHOW_AMENITIES_AS_ICONS","IB_POST_BOOKING_LOGIN","IB_IRG_PERFORMANCE_METRICS","IB_IRG_MATCH_META","META_AIR","CHILDREN_SEARCH","IB_INLINE_ROOM_GRID","HR_IB_EXCLUDE_TAXES_AND_FEES","IB_TIME_OF_STAY_PAYMENT_TYPES_V3","IB_DW_CCNAME_WITH_AUTOCOMPLETE","IB_IRG_PERFORMANCE_METRICS_MOBILE","IBEX_HIGH_EQUITY_BRANDING","IB_PRICE_WINS_POST_TX","IB_BOOKNOW_CLEAN_WITH_ICON_SHORT_BTN","IB_BOOKING_FORM_FAVICON","STORED_CARDS","IB_PRICE_WINS_COPY","IB_URGENCY_BLOCK"] , "IMPRESSION_KEY": "60f6224d61034683a117c3c29caf484f", "roomSelectionModel": {"partnerInfos":[],"multiplePartners":false,"polling":{"locationId":1109427,"bookingSessionId":null,"detailedAvailabilityKey":null,"commerceContentIds":[109245155],"additionalContentIds":[],"pollCount":0,"checkin":{"day":3,"month":6,"year":2018},"checkout":{"day":4,"month":6,"year":2018},"adults":2,"child_rm_ages":"","rooms":1,"display_rooms":300,"entryPrice":69,"entryCurrency":"USD","complete":false,"formKey":"","showAllRooms":true,"genNewBookingSessionId":false,"winningProviderAtClick":"","selectedRoomKey":"","impressionKey":"60f6224d61034683a117c3c29caf484f","navArea":null,"referringServlet":"Hotel_Review","highestMetaPrice":76,"lowestMetaPrice":69,"additionalPartner":false,"highestMetaPriceDisplay":76,"roomsToVerify":[],"clazz":null},"summary":null,"unavailable":false,"metaOffers":[],"mismatchCheckModel":null,"totalMediaCount":0,"hotelPhotos":[],"noticeHeaderMessage":null,"moreProviders":null,"lowestPricePartner":null,"showAllRooms":true,"isMetaCheaper":false,"isBookingLessThanOrEqualToMeta":null,"avgHistoricalPrice":0.0,"avgHistoricalDisplayPrice":null,"expressBookState":null,"highestMetaPrice":76,"lowestMetaPrice":69,"highestMetaPriceDisplay":76,"hotelName":"Cultivar Guest Lodge","hasSpecialTimeOfStayTaxes":false,"trackingTree":null,"trackingTreeId":null,"showPriceHoverTooltip":false,"trackingContext":"eyJzdGF0ZSI6IkhPVEVMX0FVQ1RJT04iLCJwIjoiSFJfTWFpbkNvbW1lcmNlIiwiaWRzIjp7IkJGSyI6IjYwZjYyMjRkNjEwMzQ2ODNhMTE3YzNjMjljYWY0ODRmIiwiQUlLIjoiODI1NjFiYjkwZDY2NGViZDhhYWQzNDJkMTFlNDcwODYifSwiZW50cnlTZXJ2bGV0IjoiSG90ZWxfUmV2aWV3In0=","cheaperPricesExist":false,"enableLPF":false,"priceDropPercent":0,"canExpandRooms":false,"expandRoomsToAllPartners":false,"roomSelectionKey":null,"useSupplierDirectTreatment":false,"isSupplierDirect":false,"showProviderSeparator":false,"clazz":null,"seeMoreMessage":null,"seeMoreIFrameMessage":null,"isPricelineCom":false,"isPriceDrawerEnabled":false,"isMetaMarketingLandOnBookingFormEnabled":false}, "ibAvailability": true, "metaAvailability": true, "topOfferIsIB": false, "numHacTries": 1, "checkIn": "03/06/2018", "checkOut": "04/06/2018", "lowestPrice": "US$69", "hasDates": true, "hacComplete": false, "contentIdMappings": {"109245155":"HotelsCom2IB"}, "pollingEnabled": false, "preventScroll": false, "offerClickToken": null, "conditionalUpdate": false, "mightGetRooms": false, "divClasses": "ppr_rup ppr_priv_resp_hr_room_grid", "singlePartnerRoomGridWidget": {"containerClass":null,"containerAttributes":null,"widget":{"name":"ibex_room_grid_responsive","template":"ibex_room_grid_responsive__widget","moduleList":["handlers","tracking"],"divClasses":"prw_rup prw_ibex_room_grid_responsive","js":{"handlers":"(ta.prwidgets.getjs(this,'handlers'))","tracking":"(ta.prwidgets.getjs(this,'tracking'))"},"dust":{"sub_header":"ibex_room_grid_responsive__sub_header"}},"scriptFlags":null}, "multiPartnerRoomGridWidget": null, "mismatchMessage": {"containerClass":null,"containerAttributes":null,"widget":{"name":"ibex_mismatch_message","template":"ibex_mismatch_message__widget","moduleList":["handler"],"divClasses":"prw_rup prw_ibex_mismatch_message","js":{"handler":"(ta.prwidgets.getjs(this,'handler'))"},"dust":{}},"scriptFlags":null}, "maxRoomsToShow": 300, "isTablet": false, "roomGridRowWidget": {"containerClass":null,"containerAttributes":null,"widget":{"name":"ibex_room_grid_row_responsive","template":"ibex_room_grid_row_responsive__widget","moduleList":[],"divClasses":"prw_rup prw_ibex_room_grid_row_responsive","js":{},"dust":{"amenities":"ibex_room_grid_row_responsive__amenities","occupancy":"ibex_room_grid_row_responsive__occupancy","condition_col":"ibex_room_grid_row_responsive__condition_col","price_text":"ibex_room_grid_row_responsive__price_text","reservation_col":"ibex_room_grid_row_responsive__reservation_col"}},"scriptFlags":null}, "mismatchMessageLightbox": null, "deviceInfo": "OtherOS OtherBrowser", "bookOnTripAdvisor": "Book on <img class=\"ibHeaderImg\" alt=\"TripAdvisor\" src=\"https:\/\/static.tacdn.com\/img2\/branding\/rebrand\/TA_logo_primary.png\"\/>"}
Reviews (133)
There are newer reviews for Cultivar Guest Lodge
See the most recent reviews
Filter reviews
63 results
Traveller rating
Traveller type
Time of year
More languages
Show reviews that mention
All reviewsa king size bedone nightnespresso machineshort drivemain buildinghot breakfastnice roomwine tourour honeymoonswimming poolenjoyed our staygardenmountainsvineyardsfridgeprivacywedding
Updating list...
11 - 15 of 63 reviews
Reviewed 24 September 2017

This beautiful guesthouse is located a few kilometers from Stellenbosch, but in a green surrounding with a swimming pool and a gorgious garden. The domain is completely secured. If you don't want to take your car to get out for dinner, they will gladly call...More

Thank Guido-Krystyna W
Response from CultivarGuestLodge, Owner at Cultivar Guest LodgeResponded 2 October 2017

Dear Guido, thanks a lot for your review. We´re happy to hear that you enjoyed your stay with us. Best regards Barbara

Reviewed 10 September 2017

We were advised that this was rated 5 star but unfortunately it did not make the grade. Nice room and grounds but, no TV, no extract in bathroom, only a duvet on the bed (so I was hot - usually sleep with just a sheet...More

Thank TaurangaTrout
Response from CultivarGuestLodge, Owner at Cultivar Guest LodgeResponded 2 October 2017

Dear TauranagaTrout, thank you very much for your detailed review. We´re officially listed as a 4-star hotel, I am surprised that you were advised that we´re rated 5-star. However, I understand a few of your comments and as we have just recently renovated most of...More

Reviewed 19 August 2017

Fantastic place. You look out over the wide area where you wander yourself in paradise. Within 10 minutes you are in Stellenbosch with its village atmosphere and amazing buildings and restaurants. The friendly staff is always willing to help you make your stay even better.

Review collected in partnership with this hotel
Thank yms192
Response from Barbara F, Inhaber at Cultivar Guest LodgeResponded 1 September 2017

Thanks a lot for your feedback, we´re happy that you enjoyed your stay with us!

Reviewed 7 August 2017

I wish I could say only nice things about the Guest House, and for sure the surroundings are very pretty, the bed was comfortable and the staff, that I met, were very friendly and accommodating. But the negatives were just a bit much to ignore...More

Thank ChrisCorbet
Response from Barbara F, Inhaber at Cultivar Guest LodgeResponded 14 August 2017

Dear Chris, thank you very much for your detailed and honest feedback, we really appreciate this. Let me comment on the points that you have mentioned and this will hopefully explain some of the very valid points that you have addressed. 1) Our Cabernet room...More

Reviewed 25 July 2017

Excellent buffet breakfast (the best we experienced during our month in SA!) We were made to feel very welcome, and the staff were lovely with our 22month old son. Renovation works were being done to most guest rooms during our stay (off-season, so a good...More

Review collected in partnership with this hotel
Thank shesmilesweetly
Response from Barbara F, Inhaber at Cultivar Guest LodgeResponded 14 August 2017

Hello there, thanks a lot for the positive feedback, we really appreciate this! Best regards Barbara

View more reviews
Most Booked Properties in Stellenbosch
See allSee all
Awards & Recognition
Certificate of Excellence
Top amenities
Free Parking
Free High Speed Internet (WiFi)
Breakfast included
Hotel Amenities
Free Parking
Breakfast included
Meeting Rooms
Banquet Room
Conference Facilities
Shuttle Bus Service
Airport Transportation
Laundry Service
Room amenities
Air Conditioning
Refrigerator in room
Things to do
Price range
US$77 - US$143 (Based on Average Rates for a Standard Room)
Hotel class
Room types
Non-Smoking Rooms, Suites, Family Rooms, Accessible rooms
Price range
US$77 - US$143 (Based on Average Rates for a Standard Room)
Hotel class
Room types
Non-Smoking Rooms, Suites, Family Rooms, Accessible rooms
Add Photo Photos
Traveller (96)
Room & Suite (25)
Pool & Beach (12)
Dining (6)
Questions & Answers
Ask a question
Steve B
13 January 2016|
Response from CultivarGuestLodge | Property representative |
Dear Steve, yes, it is possible to book a spa treatment in advance. Please get in touch with at venue(at)culti-var-co.za. We´re looking forward to having you! Best regards Barbara
Google Translation
Room Tips
"go for the apartments with the view to the garden"
Read review
"Note there are no in-room TVs, however the unlimited fast wifi and sound system/radio provided ample digital..."
Read review
"Don't expect the room to be as described on the website"
Read review
"Use the rooms/lodges near the swimmingpool"
Read review
Is This Your TripAdvisor Listing?
Own or manage this property? Claim your listing for free to respond to reviews, update your profile and much more. Claim Your Listing